Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for smilingone 31. smilingone Lv 1 33 pts. 9,265
  2. Avatar for Skippysk8s 32. Skippysk8s Lv 1 31 pts. 9,265
  3. Avatar for tony46 33. tony46 Lv 1 30 pts. 9,263
  4. Avatar for isaksson 34. isaksson Lv 1 29 pts. 9,262
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 28 pts. 9,262
  6. Avatar for pauldunn 36. pauldunn Lv 1 26 pts. 9,248
  7. Avatar for Aubade01 37. Aubade01 Lv 1 25 pts. 9,244
  8. Avatar for fryguy 38. fryguy Lv 1 24 pts. 9,225
  9. Avatar for dcrwheeler 39. dcrwheeler Lv 1 23 pts. 9,200
  10. Avatar for manu8170 40. manu8170 Lv 1 22 pts. 9,195

Comments