Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for thewholeblahthing 91. thewholeblahthing Lv 1 1 pt. 8,690
  2. Avatar for toshiue 92. toshiue Lv 1 1 pt. 8,684
  3. Avatar for SKSbell 93. SKSbell Lv 1 1 pt. 8,676
  4. Avatar for rinze 94. rinze Lv 1 1 pt. 8,647
  5. Avatar for bcre8tvv 95. bcre8tvv Lv 1 1 pt. 8,642
  6. Avatar for martinf 96. martinf Lv 1 1 pt. 8,630
  7. Avatar for mitarcher 97. mitarcher Lv 1 1 pt. 8,600
  8. Avatar for Savas 98. Savas Lv 1 1 pt. 8,590
  9. Avatar for aiden123 99. aiden123 Lv 1 1 pt. 8,585
  10. Avatar for KingLear 100. KingLear Lv 1 1 pt. 8,577

Comments