Placeholder image of a protein
Icon representing a puzzle

1487: Unsolved De-novo Freestyle 127

Closed since about 8 years ago

Intermediate Overall Prediction

Summary

Created
February 22, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


KLRIRIDGVNIEIENMDDKFRKGEDEIHVDIDGIHLHLENGRWEIRVDGRHVEIRNGNMEDMRQGKDRSTITVDGHEVEMT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,482
  2. Avatar for Go Science 2. Go Science 68 pts. 9,288
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 9,285
  4. Avatar for Beta Folders 4. Beta Folders 27 pts. 9,255
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 9,221
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,191
  7. Avatar for Contenders 7. Contenders 5 pts. 9,125
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 9,079
  9. Avatar for freefolder 9. freefolder 1 pt. 8,708
  10. Avatar for Richard Dawkins Foundation 10. Richard Dawkins Foundation 1 pt. 6,239
  1. Avatar for fishercat 71. fishercat Lv 1 5 pts. 8,327
  2. Avatar for weitzen 72. weitzen Lv 1 5 pts. 8,274
  3. Avatar for harvardman 73. harvardman Lv 1 5 pts. 8,259
  4. Avatar for ViJay7019 74. ViJay7019 Lv 1 4 pts. 8,227
  5. Avatar for hada 75. hada Lv 1 4 pts. 8,138
  6. Avatar for Merf 76. Merf Lv 1 4 pts. 8,100
  7. Avatar for Vincera 77. Vincera Lv 1 4 pts. 8,080
  8. Avatar for NotJim99 78. NotJim99 Lv 1 4 pts. 8,027
  9. Avatar for froggs554 79. froggs554 Lv 1 3 pts. 7,996
  10. Avatar for mitarcher 80. mitarcher Lv 1 3 pts. 7,994

Comments