Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288
  1. Avatar for u.w. 81. u.w. Lv 1 3 pts. 8,353
  2. Avatar for jausmh 82. jausmh Lv 1 2 pts. 8,350
  3. Avatar for Alistair69 83. Alistair69 Lv 1 2 pts. 8,315
  4. Avatar for boondog 84. boondog Lv 1 2 pts. 8,304
  5. Avatar for PlagueRat 85. PlagueRat Lv 1 2 pts. 8,294
  6. Avatar for rezaefar 86. rezaefar Lv 1 2 pts. 8,263
  7. Avatar for Museka 87. Museka Lv 1 2 pts. 8,215
  8. Avatar for Amphimixus 88. Amphimixus Lv 1 2 pts. 8,212
  9. Avatar for alyssa_d 89. alyssa_d Lv 1 2 pts. 8,191
  10. Avatar for sydlg19 90. sydlg19 Lv 1 2 pts. 8,187

Comments