Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288

  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 1 pt. 8,180
  2. Avatar for Viech 92. Viech Lv 1 1 pt. 8,115
  3. Avatar for 181818 93. 181818 Lv 1 1 pt. 8,060
  4. Avatar for kbill974 94. kbill974 Lv 1 1 pt. 8,039
  5. Avatar for abhxyz 95. abhxyz Lv 1 1 pt. 8,038
  6. Avatar for ViJay7019 96. ViJay7019 Lv 1 1 pt. 8,030
  7. Avatar for kludbrook 97. kludbrook Lv 1 1 pt. 8,000
  8. Avatar for wky 98. wky Lv 1 1 pt. 7,968
  9. Avatar for hada 99. hada Lv 1 1 pt. 7,968
  10. Avatar for multaq 100. multaq Lv 1 1 pt. 7,960

Comments