Placeholder image of a protein
Icon representing a puzzle

1593: Revisiting Puzzle 84: Giant Anemone

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
October 29, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,886
  2. Avatar for Go Science 2. Go Science 71 pts. 9,787
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,765
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 9,741
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 9,739
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 9,696
  7. Avatar for Contenders 7. Contenders 8 pts. 9,675
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,603
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,428
  10. Avatar for Russian team 10. Russian team 2 pts. 9,288

  1. Avatar for justjustin 51. justjustin Lv 1 13 pts. 9,122
  2. Avatar for cbwest 52. cbwest Lv 1 13 pts. 9,102
  3. Avatar for heather-1 53. heather-1 Lv 1 12 pts. 9,086
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 11 pts. 9,081
  5. Avatar for alcor29 55. alcor29 Lv 1 11 pts. 9,069
  6. Avatar for Glen B 56. Glen B Lv 1 10 pts. 9,028
  7. Avatar for johngran 57. johngran Lv 1 10 pts. 9,023
  8. Avatar for katling 58. katling Lv 1 9 pts. 9,007
  9. Avatar for SKSbell 59. SKSbell Lv 1 9 pts. 8,981
  10. Avatar for georged 60. georged Lv 1 8 pts. 8,975

Comments