Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for fisherlr777 101. fisherlr777 Lv 1 1 pt. 8,934
  2. Avatar for alanshark 102. alanshark Lv 1 1 pt. 8,815
  3. Avatar for komnor 103. komnor Lv 1 1 pt. 8,651
  4. Avatar for SouperGenious 104. SouperGenious Lv 1 1 pt. 8,630
  5. Avatar for ourtown 105. ourtown Lv 1 1 pt. 8,603
  6. Avatar for dbuske 106. dbuske Lv 1 1 pt. 8,592
  7. Avatar for learp 107. learp Lv 1 1 pt. 8,537
  8. Avatar for sydlg19 108. sydlg19 Lv 1 1 pt. 8,450
  9. Avatar for Vincera 109. Vincera Lv 1 1 pt. 8,359
  10. Avatar for DaggerBall 110. DaggerBall Lv 1 1 pt. 8,268

Comments