Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups


  1. Avatar for Beta Folders 100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097

  1. Avatar for Sydefecks 91. Sydefecks Lv 1 1 pt. 9,141
  2. Avatar for vizhu2018 92. vizhu2018 Lv 1 1 pt. 9,137
  3. Avatar for pi r squared 93. pi r squared Lv 1 1 pt. 9,123
  4. Avatar for ViJay7019 94. ViJay7019 Lv 1 1 pt. 9,122
  5. Avatar for Marvelz 95. Marvelz Lv 1 1 pt. 9,104
  6. Avatar for harvardman 96. harvardman Lv 1 1 pt. 9,090
  7. Avatar for momadoc 97. momadoc Lv 1 1 pt. 9,062
  8. Avatar for henur 98. henur Lv 1 1 pt. 9,054
  9. Avatar for borattt 99. borattt Lv 1 1 pt. 8,999
  10. Avatar for BlackyAlex 100. BlackyAlex Lv 1 1 pt. 8,944

Comments