Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for RyeSnake 71. RyeSnake Lv 1 3 pts. 9,418
  2. Avatar for felixxy 72. felixxy Lv 1 2 pts. 9,388
  3. Avatar for Aminal88 73. Aminal88 Lv 1 2 pts. 9,369
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 2 pts. 9,360
  5. Avatar for rabamino12358 75. rabamino12358 Lv 1 2 pts. 9,352
  6. Avatar for GUANINJIN 76. GUANINJIN Lv 1 2 pts. 9,314
  7. Avatar for Altercomp 77. Altercomp Lv 1 2 pts. 9,313
  8. Avatar for rinze 78. rinze Lv 1 2 pts. 9,313
  9. Avatar for lconor 79. lconor Lv 1 1 pt. 9,308
  10. Avatar for rezaefar 80. rezaefar Lv 1 1 pt. 9,295

Comments