Placeholder image of a protein
Icon representing a puzzle

1792: Revisiting Puzzle 90: Heliomicin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
January 27, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,842
  2. Avatar for Go Science 2. Go Science 73 pts. 9,819
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,775
  4. Avatar for Beta Folders 4. Beta Folders 36 pts. 9,765
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 9,729
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,722
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,650
  8. Avatar for Contenders 8. Contenders 6 pts. 9,591
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 9,550
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 2 pts. 9,262
  1. Avatar for Crossed Sticks 71. Crossed Sticks Lv 1 5 pts. 8,906
  2. Avatar for rezaefar 72. rezaefar Lv 1 4 pts. 8,905
  3. Avatar for tlaran 73. tlaran Lv 1 4 pts. 8,851
  4. Avatar for hexafraction 74. hexafraction Lv 1 4 pts. 8,737
  5. Avatar for Deleted player 75. Deleted player pts. 8,732
  6. Avatar for Altercomp 76. Altercomp Lv 1 3 pts. 8,731
  7. Avatar for donuts554 77. donuts554 Lv 1 3 pts. 8,724
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 3 pts. 8,718
  9. Avatar for kotenok2000 79. kotenok2000 Lv 1 3 pts. 8,694
  10. Avatar for Pikamander2 80. Pikamander2 Lv 1 3 pts. 8,688

Comments