Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for Beta Folders 100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323

  1. Avatar for alcor29 61. alcor29 Lv 1 11 pts. 10,196
  2. Avatar for cbwest 62. cbwest Lv 1 11 pts. 10,168
  3. Avatar for christioanchauvin 63. christioanchauvin Lv 1 10 pts. 10,165
  4. Avatar for alwen 64. alwen Lv 1 10 pts. 10,159
  5. Avatar for manu8170 65. manu8170 Lv 1 9 pts. 10,147
  6. Avatar for stomjoh 66. stomjoh Lv 1 9 pts. 9,990
  7. Avatar for Pawel Tluscik 67. Pawel Tluscik Lv 1 8 pts. 9,902
  8. Avatar for SEF830 68. SEF830 Lv 1 8 pts. 9,901
  9. Avatar for Trajan464 69. Trajan464 Lv 1 8 pts. 9,897
  10. Avatar for Threeoak 70. Threeoak Lv 1 7 pts. 9,821

Comments