Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups


  1. Avatar for Beta Folders 100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323

  1. Avatar for ShadowTactics 72. ShadowTactics Lv 1 7 pts. 9,803
  2. Avatar for donuts554 73. donuts554 Lv 1 6 pts. 9,796
  3. Avatar for aendgraend 74. aendgraend Lv 1 6 pts. 9,778
  4. Avatar for Superphosphate 75. Superphosphate Lv 1 6 pts. 9,752
  5. Avatar for dldahlen 76. dldahlen Lv 1 5 pts. 9,729
  6. Avatar for rezaefar 77. rezaefar Lv 1 5 pts. 9,728
  7. Avatar for jamiexq 78. jamiexq Lv 1 5 pts. 9,716
  8. Avatar for lraguette 79. lraguette Lv 1 5 pts. 9,626
  9. Avatar for HuubR 80. HuubR Lv 1 4 pts. 9,599

Comments