Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for Phyx 11. Phyx Lv 1 71 pts. 12,333
  2. Avatar for LociOiling 12. LociOiling Lv 1 69 pts. 12,328
  3. Avatar for Galaxie 13. Galaxie Lv 1 66 pts. 12,301
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 64 pts. 12,293
  5. Avatar for RockOn 15. RockOn Lv 1 62 pts. 12,246
  6. Avatar for silent gene 16. silent gene Lv 1 59 pts. 12,243
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 57 pts. 12,190
  8. Avatar for ZeroLeak7 18. ZeroLeak7 Lv 1 55 pts. 12,188
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 53 pts. 12,166
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 51 pts. 12,162

Comments