Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for g_b 31. g_b Lv 1 33 pts. 11,919
  2. Avatar for aznarog 32. aznarog Lv 1 32 pts. 11,915
  3. Avatar for cbwest 33. cbwest Lv 1 30 pts. 11,853
  4. Avatar for johnmitch 34. johnmitch Lv 1 29 pts. 11,836
  5. Avatar for Pazithi 35. Pazithi Lv 1 28 pts. 11,799
  6. Avatar for georg137 36. georg137 Lv 1 27 pts. 11,782
  7. Avatar for Alistair69 37. Alistair69 Lv 1 26 pts. 11,746
  8. Avatar for Bletchley Park 38. Bletchley Park Lv 1 24 pts. 11,723
  9. Avatar for Visok 39. Visok Lv 1 23 pts. 11,703
  10. Avatar for BootsMcGraw 40. BootsMcGraw Lv 1 22 pts. 11,669

Comments