Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805
  1. Avatar for Pawel Tluscik 71. Pawel Tluscik Lv 1 6 pts. 10,479
  2. Avatar for Keresto 72. Keresto Lv 1 5 pts. 10,436
  3. Avatar for strong_base 73. strong_base Lv 1 5 pts. 10,389
  4. Avatar for abiogenesis 74. abiogenesis Lv 1 5 pts. 10,269
  5. Avatar for martinzblavy 75. martinzblavy Lv 1 5 pts. 10,248
  6. Avatar for Trajan464 76. Trajan464 Lv 1 4 pts. 10,243
  7. Avatar for kyoota 77. kyoota Lv 1 4 pts. 10,229
  8. Avatar for jsfoldingaccount 78. jsfoldingaccount Lv 1 4 pts. 10,228
  9. Avatar for alwen 79. alwen Lv 1 4 pts. 10,210
  10. Avatar for spdenne 80. spdenne Lv 1 4 pts. 10,202

Comments