Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups


  1. Avatar for Go Science 100 pts. 11,108
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 11,047
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 11,032
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 10,988
  5. Avatar for Contenders 5. Contenders 16 pts. 10,950
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,865
  7. Avatar for Hold My Beer 7. Hold My Beer 5 pts. 10,736
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,728
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,499
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 1 pt. 10,262

  1. Avatar for Anfinsen_slept_here 61. Anfinsen_slept_here Lv 1 7 pts. 10,049
  2. Avatar for phi16 62. phi16 Lv 1 7 pts. 10,040
  3. Avatar for andrewxc 63. andrewxc Lv 1 6 pts. 10,021
  4. Avatar for alcor29 64. alcor29 Lv 1 6 pts. 9,818
  5. Avatar for alwen 65. alwen Lv 1 6 pts. 9,809
  6. Avatar for equilibria 66. equilibria Lv 1 5 pts. 9,735
  7. Avatar for rezaefar 67. rezaefar Lv 1 5 pts. 9,729
  8. Avatar for Visok 68. Visok Lv 1 5 pts. 9,679
  9. Avatar for dahast.de 69. dahast.de Lv 1 4 pts. 9,674
  10. Avatar for argyrw 70. argyrw Lv 1 4 pts. 9,663

Comments