Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for TrhN21 101. TrhN21 Lv 1 1 pt. 8,861
  2. Avatar for ppanjala 102. ppanjala Lv 1 1 pt. 8,848
  3. Avatar for mcg666 103. mcg666 Lv 1 1 pt. 8,846
  4. Avatar for Freaknboy 104. Freaknboy Lv 1 1 pt. 8,836
  5. Avatar for Loka 105. Loka Lv 1 1 pt. 8,822
  6. Avatar for rinze 106. rinze Lv 1 1 pt. 8,807
  7. Avatar for hajtogato 107. hajtogato Lv 1 1 pt. 8,775
  8. Avatar for jerryburke 108. jerryburke Lv 1 1 pt. 8,755
  9. Avatar for volcano789 109. volcano789 Lv 1 1 pt. 8,734
  10. Avatar for xbp 110. xbp Lv 1 1 pt. 8,727

Comments