Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 5 years ago

Novice Overall Prediction

Summary

Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656
  1. Avatar for mwm64 91. mwm64 Lv 1 1 pt. 8,971
  2. Avatar for multaq 92. multaq Lv 1 1 pt. 8,967
  3. Avatar for ivalnic 93. ivalnic Lv 1 1 pt. 8,954
  4. Avatar for Dr.Sillem 94. Dr.Sillem Lv 1 1 pt. 8,932
  5. Avatar for abiogenesis 95. abiogenesis Lv 1 1 pt. 8,930
  6. Avatar for KraszewskiK 96. KraszewskiK Lv 1 1 pt. 8,916
  7. Avatar for AlkiP0Ps 97. AlkiP0Ps Lv 1 1 pt. 8,909
  8. Avatar for Mohoernchen 98. Mohoernchen Lv 1 1 pt. 8,893
  9. Avatar for kitsoune 99. kitsoune Lv 1 1 pt. 8,889
  10. Avatar for Trajan464 100. Trajan464 Lv 1 1 pt. 8,876

Comments