Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Tehnologik1 31. Tehnologik1 Lv 1 32 pts. 9,997
  2. Avatar for stomjoh 32. stomjoh Lv 1 30 pts. 9,993
  3. Avatar for nicobul 33. nicobul Lv 1 29 pts. 9,993
  4. Avatar for Maerlyn138 34. Maerlyn138 Lv 1 28 pts. 9,985
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 27 pts. 9,984
  6. Avatar for equilibria 36. equilibria Lv 1 25 pts. 9,981
  7. Avatar for Deleted player 37. Deleted player pts. 9,972
  8. Avatar for rezaefar 38. rezaefar Lv 1 23 pts. 9,971
  9. Avatar for OWM3 39. OWM3 Lv 1 22 pts. 9,971
  10. Avatar for Skippysk8s 40. Skippysk8s Lv 1 21 pts. 9,967

Comments