Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for MicElephant 11. MicElephant Lv 1 70 pts. 10,102
  2. Avatar for jausmh 12. jausmh Lv 1 68 pts. 10,076
  3. Avatar for Phyx 13. Phyx Lv 1 65 pts. 10,071
  4. Avatar for toshiue 14. toshiue Lv 1 63 pts. 10,071
  5. Avatar for jobo0502 15. jobo0502 Lv 1 60 pts. 10,069
  6. Avatar for Lotus23 16. Lotus23 Lv 1 58 pts. 10,062
  7. Avatar for guineapig 17. guineapig Lv 1 56 pts. 10,062
  8. Avatar for gmn 18. gmn Lv 1 54 pts. 10,058
  9. Avatar for fpc 19. fpc Lv 1 52 pts. 10,055
  10. Avatar for Deleted player 20. Deleted player pts. 10,053

Comments