Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241
  1. Avatar for Bullald 91. Bullald Lv 1 2 pts. 8,390
  2. Avatar for matlen 92. matlen Lv 1 2 pts. 8,374
  3. Avatar for davidandersoniii 93. davidandersoniii Lv 1 2 pts. 8,373
  4. Avatar for Skulduggery 94. Skulduggery Lv 1 1 pt. 8,367
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 1 pt. 8,352
  6. Avatar for cbwest 96. cbwest Lv 1 1 pt. 8,340
  7. Avatar for BadStructure 97. BadStructure Lv 1 1 pt. 8,332
  8. Avatar for kinase99 98. kinase99 Lv 1 1 pt. 8,319
  9. Avatar for Flikes 99. Flikes Lv 1 1 pt. 8,311
  10. Avatar for evifnoskcaj 100. evifnoskcaj Lv 1 1 pt. 8,298

Comments