Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241
  1. Avatar for Amynet 81. Amynet Lv 1 3 pts. 8,545
  2. Avatar for vincentvanghost 82. vincentvanghost Lv 1 3 pts. 8,535
  3. Avatar for ARLUC 83. ARLUC Lv 1 3 pts. 8,504
  4. Avatar for lionheart99 84. lionheart99 Lv 1 3 pts. 8,493
  5. Avatar for mart0258 85. mart0258 Lv 1 2 pts. 8,482
  6. Avatar for cerimis 86. cerimis Lv 1 2 pts. 8,477
  7. Avatar for LELE1964 87. LELE1964 Lv 1 2 pts. 8,462
  8. Avatar for RockOn 88. RockOn Lv 1 2 pts. 8,462
  9. Avatar for dominik.komzik 89. dominik.komzik Lv 1 2 pts. 8,456
  10. Avatar for Alistair69 90. Alistair69 Lv 1 2 pts. 8,441

Comments