Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since over 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241

  1. Avatar for argyrw 71. argyrw Lv 1 5 pts. 8,760
  2. Avatar for rezaefar 72. rezaefar Lv 1 5 pts. 8,718
  3. Avatar for rinze 73. rinze Lv 1 5 pts. 8,667
  4. Avatar for Dr.Sillem 74. Dr.Sillem Lv 1 5 pts. 8,663
  5. Avatar for Pulsar1 75. Pulsar1 Lv 1 4 pts. 8,634
  6. Avatar for kentish_alex 76. kentish_alex Lv 1 4 pts. 8,629
  7. Avatar for soquasi 77. soquasi Lv 1 4 pts. 8,620
  8. Avatar for ucad 78. ucad Lv 1 4 pts. 8,592
  9. Avatar for Eumene 79. Eumene Lv 1 3 pts. 8,578
  10. Avatar for Jill Townley 80. Jill Townley Lv 1 3 pts. 8,548

Comments