Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 3 years ago

Intermediate Overall Prediction

Summary


Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,141
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 12,035
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 88 pts. 12,031
  4. Avatar for Galaxie 4. Galaxie Lv 1 82 pts. 12,014
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 77 pts. 11,972
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 72 pts. 11,953
  7. Avatar for ZeroLeak7 7. ZeroLeak7 Lv 1 67 pts. 11,950
  8. Avatar for silent gene 8. silent gene Lv 1 62 pts. 11,948
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 58 pts. 11,912
  10. Avatar for SileNTViP 10. SileNTViP Lv 1 54 pts. 11,905

Comments