Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 3 years ago

Intermediate Overall Prediction

Summary

Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913
  1. Avatar for Crossed Sticks 41. Crossed Sticks Lv 1 3 pts. 11,425
  2. Avatar for Oransche 42. Oransche Lv 1 3 pts. 11,384
  3. Avatar for Kaputnik 43. Kaputnik Lv 1 2 pts. 11,342
  4. Avatar for AlkiP0Ps 44. AlkiP0Ps Lv 1 2 pts. 11,332
  5. Avatar for Trajan464 45. Trajan464 Lv 1 2 pts. 11,325
  6. Avatar for Hellcat6 46. Hellcat6 Lv 1 2 pts. 11,289
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 11,286
  8. Avatar for kyoota 48. kyoota Lv 1 1 pt. 11,284
  9. Avatar for jamestpierce 49. jamestpierce Lv 1 1 pt. 11,277
  10. Avatar for rezaefar 50. rezaefar Lv 1 1 pt. 11,253

Comments