Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since almost 4 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913

  1. Avatar for jobo0502 11. jobo0502 Lv 1 50 pts. 11,890
  2. Avatar for g_b 12. g_b Lv 1 46 pts. 11,879
  3. Avatar for maithra 13. maithra Lv 1 43 pts. 11,859
  4. Avatar for Zosa 14. Zosa Lv 1 40 pts. 11,845
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 37 pts. 11,837
  6. Avatar for MicElephant 16. MicElephant Lv 1 34 pts. 11,819
  7. Avatar for equilibria 17. equilibria Lv 1 31 pts. 11,794
  8. Avatar for manu8170 18. manu8170 Lv 1 29 pts. 11,793
  9. Avatar for alcor29 19. alcor29 Lv 1 26 pts. 11,774
  10. Avatar for Lotus23 20. Lotus23 Lv 1 24 pts. 11,717

Comments