Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 3 years ago

Intermediate Overall Prediction

Summary

Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913
  1. Avatar for fiendish_ghoul 21. fiendish_ghoul Lv 1 22 pts. 11,709
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 20 pts. 11,676
  3. Avatar for jausmh 23. jausmh Lv 1 19 pts. 11,675
  4. Avatar for akaaka 24. akaaka Lv 1 17 pts. 11,652
  5. Avatar for zippyc137 25. zippyc137 Lv 1 15 pts. 11,626
  6. Avatar for Deleted player 26. Deleted player 14 pts. 11,617
  7. Avatar for infjamc 27. infjamc Lv 1 13 pts. 11,602
  8. Avatar for bamh 28. bamh Lv 1 12 pts. 11,580
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 11 pts. 11,568
  10. Avatar for SemperRabbit 30. SemperRabbit Lv 1 10 pts. 11,559

Comments