Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since almost 4 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 9 pts. 11,546
  2. Avatar for CharaLilith 32. CharaLilith Lv 1 8 pts. 11,543
  3. Avatar for guineapig 33. guineapig Lv 1 7 pts. 11,542
  4. Avatar for phi16 34. phi16 Lv 1 6 pts. 11,538
  5. Avatar for Blipperman 35. Blipperman Lv 1 6 pts. 11,522
  6. Avatar for Beany 36. Beany Lv 1 5 pts. 11,493
  7. Avatar for fpc 37. fpc Lv 1 5 pts. 11,490
  8. Avatar for gmn 38. gmn Lv 1 4 pts. 11,484
  9. Avatar for NeLikomSheet 39. NeLikomSheet Lv 1 4 pts. 11,457
  10. Avatar for jsfoldingaccount 40. jsfoldingaccount Lv 1 3 pts. 11,430

Comments