Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 3 years ago

Intermediate Overall Prediction

Summary

Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913
  1. Avatar for Gonegirl 51. Gonegirl Lv 1 1 pt. 11,246
  2. Avatar for Zhang Ruichong 52. Zhang Ruichong Lv 1 1 pt. 11,183
  3. Avatar for RockOn 53. RockOn Lv 1 1 pt. 11,169
  4. Avatar for Wiz kid 54. Wiz kid Lv 1 1 pt. 11,150
  5. Avatar for MrZanav 55. MrZanav Lv 1 1 pt. 11,136
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 1 pt. 11,112
  7. Avatar for dahast.de 57. dahast.de Lv 1 1 pt. 10,913
  8. Avatar for Dhalion 58. Dhalion Lv 1 1 pt. 10,901
  9. Avatar for Dr.Sillem 59. Dr.Sillem Lv 1 1 pt. 10,894
  10. Avatar for kevin everington 60. kevin everington Lv 1 1 pt. 10,827

Comments