Placeholder image of a protein
Icon representing a puzzle

2173: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since over 3 years ago

Intermediate Overall Prediction

Summary

Created
July 14, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.



Sequence:


AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,165
  2. Avatar for Go Science 2. Go Science 52 pts. 12,040
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 11,890
  4. Avatar for Contenders 4. Contenders 10 pts. 11,866
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 11,748
  6. Avatar for Gargleblasters 6. Gargleblasters 1 pt. 11,522
  7. Avatar for Australia 7. Australia 1 pt. 11,332
  8. Avatar for Team China 8. Team China 1 pt. 11,183
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 10,913
  1. Avatar for Merf 61. Merf Lv 1 1 pt. 10,823
  2. Avatar for OperatorOrville 62. OperatorOrville Lv 1 1 pt. 10,816
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 10,783
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 10,750
  5. Avatar for Feldherren 65. Feldherren Lv 1 1 pt. 10,715
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 10,695
  7. Avatar for antibot215 67. antibot215 Lv 1 1 pt. 10,669
  8. Avatar for rinze 68. rinze Lv 1 1 pt. 10,657
  9. Avatar for robgee 69. robgee Lv 1 1 pt. 10,559
  10. Avatar for B. A. Beder 70. B. A. Beder Lv 1 1 pt. 10,553

Comments