Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for frances 111. frances Lv 1 1 pt. 8,532
  2. Avatar for Nicole Bobe 112. Nicole Bobe Lv 1 1 pt. 8,531
  3. Avatar for glomie 113. glomie Lv 1 1 pt. 8,531
  4. Avatar for vic 114. vic Lv 1 1 pt. 8,531
  5. Avatar for s2021369 115. s2021369 Lv 1 1 pt. 8,526
  6. Avatar for Ericka Orbigoso 116. Ericka Orbigoso Lv 1 1 pt. 8,525
  7. Avatar for Tina1515 117. Tina1515 Lv 1 1 pt. 8,506
  8. Avatar for ralphlloydpioquinto 118. ralphlloydpioquinto Lv 1 1 pt. 8,506
  9. Avatar for cache 119. cache Lv 1 1 pt. 8,487
  10. Avatar for TC2020232 120. TC2020232 Lv 1 1 pt. 8,473

Comments