Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for dionzonameegas 91. dionzonameegas Lv 1 1 pt. 8,613
  2. Avatar for kyfrncsc 92. kyfrncsc Lv 1 1 pt. 8,611
  3. Avatar for KewkieBean01 93. KewkieBean01 Lv 1 1 pt. 8,604
  4. Avatar for HANA Y 94. HANA Y Lv 1 1 pt. 8,586
  5. Avatar for Connie Rose 95. Connie Rose Lv 1 1 pt. 8,586
  6. Avatar for kopiko 96. kopiko Lv 1 1 pt. 8,585
  7. Avatar for Head Wolf 97. Head Wolf Lv 1 1 pt. 8,583
  8. Avatar for nanaaa 98. nanaaa Lv 1 1 pt. 8,581
  9. Avatar for Cyrelle 99. Cyrelle Lv 1 1 pt. 8,572
  10. Avatar for s2020369 100. s2020369 Lv 1 1 pt. 8,567

Comments