Icon representing a puzzle

2240: Revisiting Puzzle 59: TCR Binding Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
December 16, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,159
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,128
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 10,046
  4. Avatar for Contenders 4. Contenders 30 pts. 10,037
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 10,002
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,001
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 9,894
  8. Avatar for AlphaFold 8. AlphaFold 4 pts. 9,689
  9. Avatar for Australia 9. Australia 2 pts. 9,653
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,638
  1. Avatar for maithra 41. maithra Lv 1 16 pts. 9,487
  2. Avatar for Skippysk8s 42. Skippysk8s Lv 1 15 pts. 9,451
  3. Avatar for bamh 43. bamh Lv 1 14 pts. 9,405
  4. Avatar for Trajan464 44. Trajan464 Lv 1 13 pts. 9,404
  5. Avatar for Heysir 45. Heysir Lv 1 13 pts. 9,361
  6. Avatar for Gonegirl 46. Gonegirl Lv 1 12 pts. 9,356
  7. Avatar for RichGuilmain 47. RichGuilmain Lv 1 11 pts. 9,349
  8. Avatar for phi16 48. phi16 Lv 1 11 pts. 9,292
  9. Avatar for zippyc137 49. zippyc137 Lv 1 10 pts. 9,269
  10. Avatar for robgee 50. robgee Lv 1 9 pts. 9,225

Comments