Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for rosie4loop
    1. rosie4loop Lv 1
    100 pts. 8,849
  2. Avatar for Wanderer09 2. Wanderer09 Lv 1 94 pts. 8,723
  3. Avatar for JJ38000 3. JJ38000 Lv 1 87 pts. 8,249
  4. Avatar for WhiteOwl000 4. WhiteOwl000 Lv 1 81 pts. 8,121
  5. Avatar for DKP1 5. DKP1 Lv 1 75 pts. 8,118
  6. Avatar for arhodes 6. arhodes Lv 1 70 pts. 7,849
  7. Avatar for Anago_pie 7. Anago_pie Lv 1 65 pts. 7,748
  8. Avatar for Anne_sph 8. Anne_sph Lv 1 60 pts. 7,680
  9. Avatar for Internautant 9. Internautant Lv 1 56 pts. 7,651
  10. Avatar for sintel 10. sintel Lv 1 51 pts. 7,642

Comments