Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for LjsLJS 21. LjsLJS Lv 1 20 pts. 6,783
  2. Avatar for abmart234 22. abmart234 Lv 1 18 pts. 6,774
  3. Avatar for Moonnancy 23. Moonnancy Lv 1 16 pts. 6,617
  4. Avatar for Danielff490 24. Danielff490 Lv 1 15 pts. 6,614
  5. Avatar for Joshuamaine 25. Joshuamaine Lv 1 13 pts. 6,595
  6. Avatar for yoon_koh 26. yoon_koh Lv 1 12 pts. 6,554
  7. Avatar for Araranosatto 27. Araranosatto Lv 1 11 pts. 6,522
  8. Avatar for 9999MATT 28. 9999MATT Lv 1 10 pts. 6,493
  9. Avatar for royd 29. royd Lv 1 9 pts. 6,449
  10. Avatar for methelzadar 30. methelzadar Lv 1 8 pts. 6,320

Comments