Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for cstan096 41. cstan096 Lv 1 2 pts. 5,855
  2. Avatar for TheFinn 42. TheFinn Lv 1 2 pts. 5,419
  3. Avatar for HR 43. HR Lv 1 2 pts. 5,382
  4. Avatar for 334932 44. 334932 Lv 1 1 pt. 5,170
  5. Avatar for duncan_m 45. duncan_m Lv 1 1 pt. 5,126
  6. Avatar for NoureenAbdelrahman 46. NoureenAbdelrahman Lv 1 1 pt. 5,012
  7. Avatar for makamoka 47. makamoka Lv 1 1 pt. 4,965
  8. Avatar for appaiscool 48. appaiscool Lv 1 1 pt. 4,261
  9. Avatar for hussamaljari 49. hussamaljari Lv 1 1 pt. 2,311
  10. Avatar for Ian Schnatterly 50. Ian Schnatterly Lv 1 1 pt. 1,841

Comments