Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for yananegina 31. yananegina Lv 1 7 pts. 6,318
  2. Avatar for U202242494 32. U202242494 Lv 1 6 pts. 6,280
  3. Avatar for lin252955 33. lin252955 Lv 1 6 pts. 6,278
  4. Avatar for william.sparrow 34. william.sparrow Lv 1 5 pts. 6,268
  5. Avatar for U202143311 35. U202143311 Lv 1 4 pts. 6,223
  6. Avatar for U202141951 36. U202141951 Lv 1 4 pts. 6,221
  7. Avatar for U202241631 37. U202241631 Lv 1 3 pts. 6,215
  8. Avatar for brockmcneill 38. brockmcneill Lv 1 3 pts. 6,163
  9. Avatar for ivwaurt 39. ivwaurt Lv 1 3 pts. 5,953
  10. Avatar for SeriousSamStone 40. SeriousSamStone Lv 1 2 pts. 5,876

Comments