Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for THATCHEM_GUY 11. THATCHEM_GUY Lv 1 47 pts. 7,529
  2. Avatar for EtherealSun 12. EtherealSun Lv 1 44 pts. 7,460
  3. Avatar for Carnavious 13. Carnavious Lv 1 40 pts. 7,400
  4. Avatar for monosii 14. monosii Lv 1 37 pts. 7,308
  5. Avatar for U202240409 15. U202240409 Lv 1 34 pts. 7,223
  6. Avatar for ml4268 16. ml4268 Lv 1 31 pts. 7,136
  7. Avatar for Kneevor 17. Kneevor Lv 1 28 pts. 6,878
  8. Avatar for ricemilkk_ 18. ricemilkk_ Lv 1 26 pts. 6,866
  9. Avatar for Deleted player 19. Deleted player 24 pts. 6,790
  10. Avatar for PankreasCupang 20. PankreasCupang Lv 1 22 pts. 6,787

Comments