Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Beginner

Summary

Created
April 17, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for SHELL
    1. SHELL
    100 pts. 7,223
  2. Avatar for CBRC 2. CBRC 14 pts. 6,554
  3. Avatar for Go Science 3. Go Science 1 pt. 6,493
  4. Avatar for Villanova ChE 4. Villanova ChE 1 pt. 0
  1. Avatar for eggomylego 51. eggomylego Lv 1 1 pt. 0
  2. Avatar for WuWTq 52. WuWTq Lv 1 1 pt. 0
  3. Avatar for Alyasana.Aljaizany 53. Alyasana.Aljaizany Lv 1 1 pt. 0
  4. Avatar for DrMabose 54. DrMabose Lv 1 1 pt. 0
  5. Avatar for samjs50@icloud.com 55. samjs50@icloud.com Lv 1 1 pt. 0
  6. Avatar for savethewhales 56. savethewhales Lv 1 1 pt. 0
  7. Avatar for caitlinvaca 57. caitlinvaca Lv 1 1 pt. 0
  8. Avatar for Yovinio 58. Yovinio Lv 1 1 pt. 0
  9. Avatar for sswider 59. sswider Lv 1 1 pt. 0
  10. Avatar for becky830 60. becky830 Lv 1 1 pt. 0

Comments