Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140
  1. Avatar for pruneau_44 71. pruneau_44 Lv 1 1 pt. 7,929
  2. Avatar for 146075 72. 146075 Lv 1 1 pt. 7,900
  3. Avatar for borattt 73. borattt Lv 1 1 pt. 7,795
  4. Avatar for furi0us 74. furi0us Lv 1 1 pt. 7,767
  5. Avatar for bergie72 75. bergie72 Lv 1 1 pt. 7,684
  6. Avatar for Swapper242 76. Swapper242 Lv 1 1 pt. 7,622
  7. Avatar for Dpadillaleos 77. Dpadillaleos Lv 1 1 pt. 7,514
  8. Avatar for deathbat_87 78. deathbat_87 Lv 1 1 pt. 7,435

Comments