Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140

  1. Avatar for wosser1 61. wosser1 Lv 1 1 pt. 8,282
  2. Avatar for crabapple 62. crabapple Lv 1 1 pt. 8,277
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 1 pt. 8,239
  4. Avatar for pizpot 64. pizpot Lv 1 1 pt. 8,164
  5. Avatar for froschi2 65. froschi2 Lv 1 1 pt. 8,153
  6. Avatar for rezaefar 66. rezaefar Lv 1 1 pt. 8,139
  7. Avatar for quackquack 67. quackquack Lv 1 1 pt. 8,091
  8. Avatar for woohs0125 68. woohs0125 Lv 1 1 pt. 8,088
  9. Avatar for TooDice 69. TooDice Lv 1 1 pt. 8,063
  10. Avatar for AmphotericinB 70. AmphotericinB Lv 1 1 pt. 8,021

Comments