Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 8,928
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 1 pt. 8,892
  3. Avatar for CDSoffice 53. CDSoffice Lv 1 1 pt. 8,879
  4. Avatar for hada 54. hada Lv 1 1 pt. 8,697
  5. Avatar for RichGuilmain 55. RichGuilmain Lv 1 1 pt. 8,587
  6. Avatar for Trajan464 56. Trajan464 Lv 1 1 pt. 8,585
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 8,365
  8. Avatar for Steven Pletsch 58. Steven Pletsch Lv 1 1 pt. 8,361
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 8,310
  10. Avatar for Just_A_Nerd 60. Just_A_Nerd Lv 1 1 pt. 8,296

Comments