Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140
  1. Avatar for maithra 31. maithra Lv 1 9 pts. 9,987
  2. Avatar for manu8170 32. manu8170 Lv 1 8 pts. 9,948
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 7 pts. 9,861
  4. Avatar for argyrw 34. argyrw Lv 1 7 pts. 9,839
  5. Avatar for nicobul 35. nicobul Lv 1 6 pts. 9,808
  6. Avatar for roarshock 36. roarshock Lv 1 5 pts. 9,801
  7. Avatar for ivalnic 37. ivalnic Lv 1 5 pts. 9,744
  8. Avatar for equilibria 38. equilibria Lv 1 4 pts. 9,726
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 4 pts. 9,726
  10. Avatar for Oransche 40. Oransche Lv 1 3 pts. 9,582

Comments