Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140
  1. Avatar for carxo 41. carxo Lv 1 3 pts. 9,422
  2. Avatar for Alistair69 42. Alistair69 Lv 1 3 pts. 9,353
  3. Avatar for ProfVince 43. ProfVince Lv 1 2 pts. 9,339
  4. Avatar for Merf 44. Merf Lv 1 2 pts. 9,303
  5. Avatar for Wiz kid 45. Wiz kid Lv 1 2 pts. 9,288
  6. Avatar for Dr.Sillem 46. Dr.Sillem Lv 1 2 pts. 9,240
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 2 pts. 9,180
  8. Avatar for AlphaFold2 48. AlphaFold2 Lv 1 1 pt. 9,140
  9. Avatar for zbp 49. zbp Lv 1 1 pt. 9,121
  10. Avatar for Larini 50. Larini Lv 1 1 pt. 9,009

Comments