Icon representing a puzzle

2324: Revisiting Puzzle 86: Nematode

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,191
  2. Avatar for Go Science 2. Go Science 56 pts. 11,127
  3. Avatar for Contenders 3. Contenders 29 pts. 11,093
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 10,823
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 10,616
  6. Avatar for Gargleblasters 6. Gargleblasters 2 pts. 10,594
  7. Avatar for Australia 7. Australia 1 pt. 10,439
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,345
  9. Avatar for VeFold 9. VeFold 1 pt. 9,422
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,140

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 11,207
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 11,189
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 88 pts. 11,127
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 82 pts. 11,093
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 11,079
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 72 pts. 10,939
  7. Avatar for Galaxie 7. Galaxie Lv 1 67 pts. 10,924
  8. Avatar for Wanderer09 8. Wanderer09 Lv 1 63 pts. 10,916
  9. Avatar for blazegeek 9. blazegeek Lv 1 58 pts. 10,906
  10. Avatar for MicElephant 10. MicElephant Lv 1 54 pts. 10,902

Comments