Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233
  1. Avatar for Larini 41. Larini Lv 1 2 pts. 41,041
  2. Avatar for VU21BTEN0100031 42. VU21BTEN0100031 Lv 1 2 pts. 41,033
  3. Avatar for VU21BTEN0100033 43. VU21BTEN0100033 Lv 1 2 pts. 41,001
  4. Avatar for Idiotboy 44. Idiotboy Lv 1 1 pt. 40,987
  5. Avatar for erlorad 45. erlorad Lv 1 1 pt. 40,934
  6. Avatar for Miffed 46. Miffed Lv 1 1 pt. 40,922
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 40,881
  8. Avatar for carsonfb 48. carsonfb Lv 1 1 pt. 40,747
  9. Avatar for Dr.Sillem 49. Dr.Sillem Lv 1 1 pt. 40,739
  10. Avatar for man_the_stan 50. man_the_stan Lv 1 1 pt. 40,575

Comments