Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 40,449
  2. Avatar for Merf 52. Merf Lv 1 1 pt. 40,394
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 40,237
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 40,146
  5. Avatar for silent gene 55. silent gene Lv 1 1 pt. 40,123
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 40,082
  7. Avatar for furi0us 57. furi0us Lv 1 1 pt. 40,039
  8. Avatar for Arlind1 58. Arlind1 Lv 1 1 pt. 40,023
  9. Avatar for evifnoskcaj 59. evifnoskcaj Lv 1 1 pt. 39,990
  10. Avatar for Helisaf 60. Helisaf Lv 1 1 pt. 39,977

Comments