Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233
  1. Avatar for alcor29 21. alcor29 Lv 1 19 pts. 41,825
  2. Avatar for AlkiP0Ps 22. AlkiP0Ps Lv 1 17 pts. 41,766
  3. Avatar for WBarme1234 23. WBarme1234 Lv 1 16 pts. 41,741
  4. Avatar for Bletchley Park 24. Bletchley Park Lv 1 14 pts. 41,734
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 13 pts. 41,731
  6. Avatar for fpc 26. fpc Lv 1 11 pts. 41,704
  7. Avatar for Joanna_H 27. Joanna_H Lv 1 10 pts. 41,494
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 9 pts. 41,455
  9. Avatar for manu8170 29. manu8170 Lv 1 8 pts. 41,442
  10. Avatar for BarrySampson 30. BarrySampson Lv 1 7 pts. 41,431

Comments