Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233
  1. Avatar for froschi2 61. froschi2 Lv 1 1 pt. 39,943
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 39,935
  3. Avatar for Arne Heessels 63. Arne Heessels Lv 1 1 pt. 39,922
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 39,852
  5. Avatar for zo3xiaJonWeinberg 65. zo3xiaJonWeinberg Lv 1 1 pt. 39,409
  6. Avatar for c-lindane 66. c-lindane Lv 1 1 pt. 38,433
  7. Avatar for Rocky Roccoco 67. Rocky Roccoco Lv 1 1 pt. 36,646
  8. Avatar for 5lboy0609 68. 5lboy0609 Lv 1 1 pt. 25,562
  9. Avatar for folder20 69. folder20 Lv 1 1 pt. 25,529
  10. Avatar for orily1337 70. orily1337 Lv 1 1 pt. 25,529

Comments