Icon representing a puzzle

2489: Revisiting Puzzle 67: Integrase

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
July 12, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,567
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,514
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,428
  4. Avatar for Contenders 4. Contenders 33 pts. 10,417
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,391
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 14 pts. 10,379
  7. Avatar for Team China 7. Team China 8 pts. 10,288
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 10,283
  9. Avatar for Australia 9. Australia 3 pts. 10,241
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 2 pts. 10,233
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 49 pts. 10,417
  2. Avatar for orily1337 12. orily1337 Lv 1 46 pts. 10,391
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 42 pts. 10,379
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 39 pts. 10,378
  5. Avatar for fpc 15. fpc Lv 1 36 pts. 10,378
  6. Avatar for Aubade01 16. Aubade01 Lv 1 33 pts. 10,362
  7. Avatar for blazegeek 17. blazegeek Lv 1 31 pts. 10,343
  8. Avatar for gmn 18. gmn Lv 1 28 pts. 10,320
  9. Avatar for g_b 19. g_b Lv 1 26 pts. 10,316
  10. Avatar for Zhang Ruichong 20. Zhang Ruichong Lv 1 24 pts. 10,288

Comments